SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330502|ref|NP_441230.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330502|ref|NP_441230.1|
Domain Number 1 Region: 118-299,434-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.81e-108
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000604
Further Details:      
 
Domain Number 2 Region: 296-429
Classification Level Classification E-value
Superfamily GAD domain-like 2.94e-33
Family GAD domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.45e-31
Family Anticodon-binding domain 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330502|ref|NP_441230.1|
Sequence length 599
Comment aspartyl-tRNA synthetase [Synechocystis sp. PCC 6803]
Sequence
MRTHYCGDLRTTHLGETVTLYGWVDRRRDHGGVIFLDLRDRQGIVQIASSPDQTPASYPV
AEGLRNEYVVQVTGVVSKRPPESLNEKIPTGEIEIYADSIILLNGVNQQLPFVVSSHEAE
QVREDVRLKYRYLDLRRARLSQNLQLRHQVVKAMRRFLEDQENFLEIETPILTRSTPEGA
RDYLVPSRVNPGEWYALPQSPQLFKQLLMVAGMDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFMGQEEILDLNEALICHIFKVVKNIDLPRPFPRLTYQESMAKYGNDRPDTRFGLEL
VDVSDLLGNTGFKVFSAAVSSGGSIKAIRVPGGNETISNVRIKPGGDLFKEATEAGAKGI
AYIRVRDNGEIDTIGAIKENLDEAQVKTLLQLTQAEAGDLLLFGAGDTATVDKSLSRLRL
VLGEQLGLIDPDAINLLWITDFPMFEWNSDEKRFEALHHPFTAPHPDDLGDLKTARAQAY
DLVMNGVEIGGGSLRIYQREVQEKVFATIGLSPEEAHEKFGFLLDAFEYGTPPHGGIAYG
LDRLVMLLAKEDSIRDVIAFPKTQQASCLLTEAPAAVDKKQLKELSVASTYVPKVKVDD
Download sequence
Identical sequences P73851
1148.slr1720 gi|383325412|ref|YP_005386265.1| gi|383322243|ref|YP_005383096.1| WP_010872537.1.11876 WP_010872537.1.1889 WP_010872537.1.18904 WP_010872537.1.33690 WP_010872537.1.35395 WP_010872537.1.47586 WP_010872537.1.99424 gi|16330502|ref|NP_441230.1| gi|16330502|ref|NP_441230.1| gi|383491296|ref|YP_005408972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]