SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331120|ref|NP_441848.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331120|ref|NP_441848.1|
Domain Number - Region: 104-145
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.000279
Family AbrB N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331120|ref|NP_441848.1|
Sequence length 155
Comment hypothetical protein sll0359 [Synechocystis sp. PCC 6803]
Sequence
MLYFILCRLLKKTSPRNQASFNGKNNPMPNASTALTGKALLNKVKELSHLPRRETAKACG
YYSTSKEGQVRVNLTDFYDAVLAAKGVPLDPSGTKDGRGREPTFRVSVHKNGQIVIGSTY
TQEMGLKSGDEFEIKLGYKHIHLKQITDSDDEEEV
Download sequence
Identical sequences P74426
gi|16331120|ref|NP_441848.1| gi|16331120|ref|NP_441848.1| WP_010873149.1.11876 WP_010873149.1.1889 WP_010873149.1.18904 WP_010873149.1.33690 WP_010873149.1.35395 WP_010873149.1.47586 WP_010873149.1.99424 gi|383491916|ref|YP_005409592.1| gi|383326032|ref|YP_005386885.1| gi|383322863|ref|YP_005383716.1| 1148.sll0359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]