SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331613|ref|NP_442341.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331613|ref|NP_442341.1|
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.88e-23
Family Single-domain sulfurtransferase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331613|ref|NP_442341.1|
Sequence length 114
Comment hypothetical protein slr0192 [Synechocystis sp. PCC 6803]
Sequence
MTSMPIEISVQDLALMLAHPNGDRQLIDVREPHEVEIAALPGFETLSLSEFAQWSGTIRE
RYDGEKETVVLCHHGIRSDQMAHWLVDQGFSKVKNVVGGIDAYSRLIDATIPCY
Download sequence
Identical sequences L8ARB6 Q55764
1148.slr0192 gi|383492408|ref|YP_005410085.1| gi|383326524|ref|YP_005387378.1| gi|16331613|ref|NP_442341.1| gi|383323355|ref|YP_005384209.1| gi|16331613|ref|NP_442341.1| WP_010873638.1.11876 WP_010873638.1.1889 WP_010873638.1.18904 WP_010873638.1.33690 WP_010873638.1.35395 WP_010873638.1.47586 WP_010873638.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]