SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332292|ref|NP_443020.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332292|ref|NP_443020.1|
Domain Number 1 Region: 63-162
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.88e-31
Family Multidomain sulfurtransferase (rhodanese) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332292|ref|NP_443020.1|
Sequence length 164
Comment hypothetical protein slr1184 [Synechocystis sp. PCC 6803]
Sequence
MASIVFRYLTVLVFSLCLMGFFSPPTLAAGSPPLLNSELNPQTQTMDLAIDSFLDSIPAN
YYAIRTPAALKKRLDDAKTTLVDVREVKEYQAGHIPGAINIPLRTLSHNLAQIPPDRKVI
FYCSTGYRSAMAMMALNLLGYENVLAFSPSFTGWQAAGEAIAKA
Download sequence
Identical sequences P74713
gi|383327202|ref|YP_005388056.1| gi|16332292|ref|NP_443020.1| gi|383493086|ref|YP_005410763.1| gi|16332292|ref|NP_443020.1| 1148.slr1184 WP_010874312.1.11876 WP_010874312.1.1889 WP_010874312.1.18904 WP_010874312.1.33690 WP_010874312.1.35395 WP_010874312.1.47586 WP_010874312.1.99424 gi|383324033|ref|YP_005384887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]