SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505658|ref|NP_942279.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505658|ref|NP_942279.1|
Domain Number 1 Region: 18-142
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 3.49e-39
Family LexA-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505658|ref|NP_942279.1|
Sequence length 144
Comment hypothetical protein sll5123 [Synechocystis sp. PCC 6803]
Sequence
MPANVLPEIYRPSRRTVYELPLYACPVSAGFPSPAEDYLEGKLDLNQYLIKHPAATFFVR
VTGDSMIGAGIHAGDILIVDRSLEPRDGKVVIAVVNGELLVKRLRMEKQKIYLASENSDY
PPLVITDLMDFEVWGVVTNVIHPL
Download sequence
Identical sequences Q6ZEK7
WP_011153660.1.1889 WP_011153660.1.35395 gi|38505658|ref|NP_942279.1| 1148.sll5123 gi|38505658|ref|NP_942279.1|NC_005229 gi|451816666|ref|YP_007459869.1|NC_020296 gi|38505658|ref|NP_942279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]