SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBG08996 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08996
Domain Number 1 Region: 54-105
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.000000000000012
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00091
Further Details:      
 
Domain Number 2 Region: 3-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000016
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08996   Protein: CBP08150   Gene: WBGene00030672
Sequence length 134
Comment CBP08150 WBGene00030672 status:Predicted UniProt:A8X820
Sequence
MSSYALYRGTTLGQALDQTLNDMEADGLLPKSLVSKVLMQFDKSMNKQISRLPKEKMNFC
ATQLLTYRYCDNVWTFILNNVNLKDPQRSFDEPIEKLKIVACDGRQTSLLQTLGQGPSKR
VARAAGDDEDDDSD
Download sequence
Identical sequences A0A2G5US60 A8X820
XP_002641144.1.8413 6238.CBG08996 CBG08996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]