SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBG12654 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12654
Domain Number 1 Region: 83-315
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.35e-76
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000593
Further Details:      
 
Domain Number 2 Region: 11-83,320-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.44e-71
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12654   Protein: CBP28980   Gene: WBGene00033571
Sequence length 521
Comment CBP28980 WBGene00033571 status:Predicted UniProt:A8XG95
Sequence
MAMANNGSVANKVCLIVIDGWGISEDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGL
PEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNQLVANENLVDACNRAKNGNGRLHLA
GLVSDGGVHSHIDHMFALIKAIKELGVPELYLHFYGDGRDTSPNSGIGFLQQTLDFLEKD
VGYGKLATVVGRYYAMDRDKRWERINVAYEAMIGGVGENSDEAGVVEVVRKRYAADETDE
FLKPIILQGEKGRVQNDDTLVFFDYRADRMREISEVMGMERYKDCNSKLTHPSNVQVYGM
TQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGE
ERCLVPSPKVATYDLQPEMSAAGVADKMVEQIEAGTHPFIMCNFAPPDMVGHTGVYEAAV
KACEATDVAIGRIYEATQKYGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPG
FKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGASIVQKI
Download sequence
Identical sequences A8XG95
6238.CBG12654 CBG12654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]