SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBG14578 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14578
Domain Number 1 Region: 1772-1997
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000425
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 1371-1630
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000536
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 3 Region: 765-986
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000105
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 4 Region: 1983-2200
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000589
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  CBG14578
Domain Number - Region: 555-764
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0074
Further Details:      
 
Domain Number - Region: 973-1078
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14578   Protein: CBP33304   Gene: WBGene00035028
Sequence length 2488
Comment CBP33304 WBGene00035028 locus:Cbr-lfi-1 status:Predicted UniProt:A8XK84
Sequence
MFFSCGVNSSTPGRQLVVSEALPESALHDPPSQALRTLSPVSPPTANSSSSTSRSCSPVV
RAEAIVPGKWTHISGKVSVRPLTPSETESVLDRQRQKVQRSSRKDKLKMSSHDDTRSSGG
GGDGTIHIPSADSKEPTPESPGSRSNYGEFYCPTTDSLKTYSYTIHMKKTEEETHEYDSD
TWDEYSRDTSGENNYHNTSSFDDDLLLEIDSSRGAAVARLDRTQRQKFQDDLNKFRQRID
NNVEQQREYSEMMASLQNKVHEYRKHIAELEGRMVGARNRMLDDPSSNVMIFDNYDPGNT
YITNHNVELWSPARGKRETILGGGGAGGLTTVNVHTGAGLGGFGSSGVAGYGGGQAGDPN
ANYEMIARLDEERRRSDEYRMQWENERQKSLALEDENDRLRREFERYANDSKDKEKTFVN
RERNLAQYLSDEQRKMLDLWTELQRVRKQFSDLKVQTEEDLDKQKTEFTRALRNVSSISR
NATFTGGAGDSLGLFGLDDGIDVNRTTNNYEKVLIETVKRINTGKAGGASSAELLEELRK
IRGGGSSEGDAELHKELMTKYEESIERNIELESKGDDAQRKIAELEAELRRNREKLNEHQ
SALKKLHEMAQDSEKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDIQQLE
RKLKIAESQAKEFLNKFENADEARRRLDKQLADAKREISNLQKSFDETERTSRRTEDKLR
ASEAERVAAEKARKFLEDELAKLQASFQKSTTDDARKLRDEMDEHTNSIQEEFKTRIDEL
NRRIENLLRENNRLKSEVNPLKDKYRDLENEYNSTQRRIEERETQLRYADDIRKNIQKDL
DDLREKYDRVYSDNEKILGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIR
HKLETEIKGRQDLQKNGARSNDELDKLRQTISDYESQINLLRRHNDELDTTIKGHQGKLT
QLENELHSRSGEIEKLNDLNQRLQKEKQEVLNQKLKLDGDVQALKETIRKLENELEKLRT
ENKELVGKEARARDAANQHLSRANLLNKELDDTKQDLKHSSEVNKQLEQDIRDLKERLAN
MGRGGRVSRDSTTTGTDGGAFGDRSSVADANRSRGAAGTDVYIPAAEDIESRGSGEINIP
SSTGDVIHGRDGRDGRDATGQRGTHTITNTKERIERIEKNILDRYHDDELAEHKIREIND
RWKRELERLENDKDDLERRIRELEDELSQIGRGNDKTENDITELKRKHAAEIDKLKSDIS
ALHDKHLSDLDDEKEQYGKAVENLKSVEDDLRDKLNNLEKQLADSLNRENVLEREKRDYD
EKVNSLYTQNQKIKDEWDDFRNDADKEIQKWKTDAYTVRSEAKALETTNTALKAQLQAAQ
DRIDHLTKTVNDHTAKVRDLTSQIRRLEDELSDSKGNLVQKEMDLESAQNRLRSLEDQYS
TLQSDSNKWRGDLDAALRENDVLKSNNTNMEADLTRLKNRLKSAEDALKELKSSLSHAKT
EKERLQNAFREKTKQADHLNQLASQFDTKLTKLRNELQDTNDKLITSDTERTALRNELQK
LSQELKFGNEQIQRKSDEYQTTIDDLAHSHRVSEDSRLNALQELEARKYEINDLTSRLDS
TEQRLATLQQDYIKADSERDILSDALRRFQSSANRVINFHTFVDGGTGYVDGGASVIGGG
PSAQRSGAYDPVSGGGAETGISGGPGGSDFGREIEIGRGDSDLSDVAYPRSVPFPPSADY
SSGRPGATSAGGRVINNIDGTTTVNMNGGFDIANLEGTLQSLLNKIEKLEMERNELRDTL
ARMKKKTTETHTTINQKETRYRNIEDNLQDAEEERRALESRLASAKTLLRSQEEALKQRD
EERRQMKSKMVAAELQARGKEAQLRHLNEQLKNLRTDLDNAHTDIRSLRDKEEQWDSSRF
QLETKMRESDSDSNKLQLQIASFESERQILTEKIKELDGALRLSDSKVQDMKDDTDKLRR
DLTKAESVENELRKTIDIQSKTSHEYQLLKDQLVNTQNELNGANTRKQQLENELLNARSE
VRDYKQRVHDVNNRVAELQRQLQDANSEKNRVEDRFLSVEKVVNTMRTTETDLRQQLETA
KNEKRVALKELEDIKRRLSQLENERRNSSQLADGWKKEKATLMKKIELLENEKRRTDAAI
RETALQREAIEKSLNAMERENKELYKNCAQLQQQIAQLEMENGNRILELTNKQREEQERQ
LIRMRQEKGQDLQIEKVIENRERTHRNRIKQLEDQIAILRDQLDGERRRRREYVDRSMVN
DIGRLGSNVLGIRNSYGDNNIDAIINGGSRSVGFYPRSTFASNPLTPPFGTSTPTHRPHI
TDFRSAVDAGSSYRRPISTIEDSGMEVTFNTYPPQEVSFSHQQNTPVIRVHRSKSREVMH
QEVFETREMHHRSVYGGSIRDRDSVYGGGGGRDSSFGQRAGDSISRTGVEPRDPSIVEIP
SNEPIMTSSTHSQGGSRYDTLAPNRDDL
Download sequence
Identical sequences A8XK84
CBG14578 6238.CBG14578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]