SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBG24242 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG24242
Domain Number 1 Region: 67-325
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000915
Family Tropomyosin 0.006
Further Details:      
 
Domain Number 2 Region: 288-508
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000229
Family Tropomyosin 0.0052
Further Details:      
 
Weak hits

Sequence:  CBG24242
Domain Number - Region: 1313-1495
Classification Level Classification E-value
Superfamily Tropomyosin 0.00015
Family Tropomyosin 0.02
Further Details:      
 
Domain Number - Region: 2764-2821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00523
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number - Region: 2863-2919
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00575
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG24242   Protein: CBP34019   Gene: WBGene00042401
Sequence length 3139
Comment CBP34019 WBGene00042401 status:Predicted UniProt:A8WKA4
Sequence
MKILAGGTSHDTQNRSSAHKTYWKTTGIWVIRQSRINLKSAKNFSLHESVQLFKNWKKFC
DENGIPVKKALEYIRTKDRYFIKHQEERNFWVKLFDVLVDSVEVEVDSVEVLVDSVEVLV
DSVEVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVE
VLVDSVEVEVDSVELLVDSVEVLVDSVEVEVDSVEVLVDSVEVLVDSGDVEVDSVEVLVD
SVEVLVDSVEVEVDSVEVLVDSVEVLVDSVDVEVDSVEVLVDSVEVLVDSVDVEVDSVEV
LVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVLVDS
VEVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVL
VDSGDVEVDSVEVLVDSVEVLVDSVEVEVDSVEVLVDSVEVEEDSVEVLVDSVEVEVDSV
EVLVDSVEVEVDSVEVLVDSVEVLVDSVDVEVDSRRGTRGLGRCGGGFSRCTGGLGRGGG
GFTRRTRRLRRRTGRLPRGGGRSTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTS
TSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTE
STSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTST
STESTSTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTST
ESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTS
TSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTE
STSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTCT
STESTSTSTESTCTSTESTSTSTESTCTSTESTSTSTESTSTSTESTSTSTESTCTSTES
TSTSTESTCTSTESTSTSTESTCTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTS
TESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTEST
STSTESTSTSTESTSTSTESTSTSTESTCTSTESTSTSTESTSTSTESTSTSTESTSTST
ESTSTSTESTSTSTESTSTSTESTSTSTESTCTSTESTSTSTESTSTSTESTSTSTESTS
TSTESTCTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTE
STSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTCTSTESTSTSTESTST
STESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTESTSTSTES
TCTSTESTSTSTESTCTSTESTSTSTESTSTSTESTCTSTESTSTSTESTCTSTESTSTS
TNPPAPRPSPRVPRLNPPAPRPSPPVPRPNPRAPRLNPPAPRPSPPVPRPSPPVPRLNPP
APRPSPRVPRLNPPAHRPSPRVPRLNPPPPRPSPRVPRLNPPPHRLSPRVPRLSPRVLRP
NPRVPRLNPPPPRPSPRVPRLNPPPPRPSPRVPRLNPPPPRPSPRVPRLNPPPHRPSPRV
PRLNPPPPRPSPRVPRLNPPPHRPSPRVPRLNPPPPRPSPRVPRPSPRVPRLNPPPHRPS
PRVPPPSPPAPRPSPRVPRLNPPAPRPSPRVPRPSPRVPRPSPRVPRLNPPAPRPSPRVP
RLNPPAPRPSPRVPRLNPPAPRPNPRVPRPSPPAPRPSPRVPRPNPRVPRXXXXPPPPRP
SPRVPRPSPRVPRLNPPPPRPSPRVPRLNPPPPRPSPRVPRLNPPPPRPSPRVPRLNPPP
PRPSPRVPRPSPRVPRLNPPPHRPSPRVPRLNPPPPRPSPRVPRLNPPPPRPSPRVPRLN
PPPPRPSPRVPRLNPPPHRPSPRVPRLNPPPPRPSPRVHRLNPPPPRPSPRVPRPSPRVP
RLNPPAPRPSPRVPRLNPPAPRPSPRVPRLNPPAPRPSPRVPRLNPPAPRPSPRVPRLNP
PAPRPSPRVPRLNPPAHRPSPRVPRLNPLPLRLSPRVPRLNPPPHRLSPRVPRLNPPPPR
QSQPVPRPSPRVPRLNPPPPRLSPRVPRPSPRVPRLNPPPHRPSPRVPPPSPPPHRPSPR
VPRLNPPPPRPSPRVPRLNPPPPRQSPRVPRPSPRVPRPSPRVLQQTLPQLFPEPPVVQL
EDTGAIGRLMLHVLLLVDHALNKSIVVCASPKQIVVIAPEWTSKLKTVTSASVTSLWIHA
ALDTRLLFPELYISVDLSPTLPCQPPMTKLAVLWKESGEHGPNGQHALEPPVETAMDLAP
EQESAPLNPTALVVEILPNRNSAEPSPPGRNGRQLTHATKHLVVHAKPKPSLELARRPAD
VSACKLQGEATKTEYCNLAPCSSTTVCCNSLTSTTVNGVAICGPLGTKQFRVTKTSIRGC
KIPEKIQTLYPSNYCTLRIMCQLKLRCVLLQNNISSRTPKLKPIQFHVLPILQPAVCWEE
SGQNGHLETLVMTLAETVEQRHCQEFVCRMTTTVNAVEAPRKKPNVLLRHVHSQEQHVVE
LERKSLLEERSSARQRMTLIQHHRHFVLPTAAQLLEDTGLNGQLVPRAQQLVDLAQQRLR
IVSVSLRQLVHATVNCGIGVCYFPDDSCCAGYSATVVGTQHVCGPQPNYTTPYAPYDPTC
TDDCCPETGIWSEWTLSPAQCRDYCGSCGNQTRTRTCTSEADGCPCQGETTITEPCGTGV
CYFPRLSCCPGFTATVEGSNHICGPLTTAVADPDKLNTCGVTCCPSAGIWGEWVSTAGCN
DTCGSCGTETRKRKCLSLQYGCACTGDDTDTSVCASSVCLFPRTSCCAGFKKMVNITART
FYCGPLPVVPAFNPEQTTCCDPGILFVSESYSNRPLQKRPDFGTIGDHGRHAVQHAEVVE
HRAEIAPALLHHTDARARIGDSLETQSCGKQVCTTGSQCCAGKFVATGYDGAQYCQDSTP
ETCAGTWTEWAQIDGAVCNDTCGNCGVIPTQRYCFPSGCQCSGAYTGSQACANSVCLFPR
TSCCAPYKKKIVGKAFACA
Download sequence
Identical sequences 6238.CBG24242 CBG24242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]