SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000053966|PACid:22620929 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000053966|PACid:22620929
Domain Number 1 Region: 1-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-59
Family GDI-like N domain 0.0000000225
Further Details:      
 
Domain Number 2 Region: 389-427
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000712
Family GDI-like N domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000053966|PACid:22620929
Sequence length 428
Sequence
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDK
PPETLGSSKDYNVDMIPKFMMANGGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKVHKVPA
NDVEALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGMDLNKVTARELILKYGLDDNT
VDFIGHALALHRDDNYLAEPAMAFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFAR
LSAVYGGTYMLSKPECKVEFENKKAIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARA
ICIMSHPIPNTQDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETD
NPQVELKPGTDLLGAVDEIFFDTYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAM
YSKITGKV
Download sequence
Identical sequences MDP0000053966 MDP0000053966|PACid:22620929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]