SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000119779|PACid:22649695 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000119779|PACid:22649695
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.07e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000119779|PACid:22649695
Sequence length 233
Sequence
FEKINSAESILIVGGGPTGVELAGEIAIDFPEKKVTLVHRGSRLLEFIGLKASQKALDWL
ISKNVEVVLNESVNLNNVSDGFIQTSSGEVIAADCHFVCTAKPMGSSWLRESILQNDLDM
QGRLMVDRNMRVRGHKNIFAVGDITXVKEIKQGYLAQRHAEVTSENLKLLLSGRNESKMA
TYKPGLEMALVSLGRKEGIAQFPLVTISGCIPGMIKSGDLFVGKTRKRLGLKP
Download sequence
Identical sequences MDP0000119779 MDP0000119779|PACid:22649695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]