SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000121242|PACid:22676043 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000121242|PACid:22676043
Domain Number - Region: 75-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.018
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000121242|PACid:22676043
Sequence length 147
Sequence
MAGVYEKNNVAAAAAEDNLAGSSRSGEPIRNRNSYQWNPRDEPLVHEPAACQPPVLLDPP
PTPHPRLFNPQQMRFLFHKKLHNSDVRAIGRIVIPKNYFTFDTIAMYLNRISERPNAISL
SSNQRKQDYGCTWTTWTICKCGLSDSX
Download sequence
Identical sequences MDP0000121242 MDP0000121242|PACid:22676043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]