SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000123466|PACid:22652651 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123466|PACid:22652651
Domain Number 1 Region: 144-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-34
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 2 Region: 607-679
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000932
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000123466|PACid:22652651
Sequence length 864
Sequence
MARRTAAGVEGLPSTASVNAVESSGCTDAAVPAANNNQGEKDDLYHQLWHACAGANVYVP
RPGEKVFYFLQGHMEQVEAYANQDCKMEMPRYNLPSKILCNVVCVQLKAEAHTDEVYAQI
TLLPVTEEDQVRAEEENTPPLPRRTSTRSFSKVLTPSDTSTHGGFSVPKRQADECLPPLD
MSQQPPVQDLVAKDLQGYEWCFRHIFRGQPKRHLLTSGWSTFVTTKRLVAGDACIFARGE
NGELCVGIRRATKTQDTASTSLISGHSMQHGILASAFHAISTGTMFTVYYHPWTSPAAFI
IPFDQYMKSAENDYSIGMRFRMCSEGEECAEKKRLEGTIIDIEDNDCLRWPISEWRCLKV
RLDTTLDTCLHSERLSPWNIIPLQPKKRARLPDPPSPGVSSLGRKGSLVISXESTPPRKK
KVFQGQETSDPPAHEPVTPKQXLLPQFIPPPNPDWDHTDLGLENNLNVPMNDPFYQCPGY
PKAPGLTNQWPPMFGFGVFDSGTYKRSMSVPNISSSXSQNLRAFELRSETQSPLVEQKST
MLFGVNIVTSHPELPSPQVANSIELCSPCSIPPISHSSVSETVQLSETSKSISGVCSEKQ
CKKCSSVNNRSCIKVLKYGAPVGRSIDLTRFDGYNELICELDQMFDFKGSLIDGSSGCQV
TYMDDEGDRMLIGDYLWQLRTXTHAVTLTNSSPWRSDCSSVRKMKCRIQAPQMQYPSKSS
PRGHMCLSVHIRACSARERHGIDKXVYLKHQCAHCGMYANAAXTIYCSSVARPITSLRKL
PPTSTSCSKISALANVATPALNFRVPRHPIXRRNDIRKPQTAVRSQFSSNPQSNEDPDAQ
VQDLVVPQHWLTPSXALEVLLSIF
Download sequence
Identical sequences MDP0000123466|PACid:22652651 MDP0000123466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]