SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000123473|PACid:22645384 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123473|PACid:22645384
Domain Number 1 Region: 109-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000122
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000123473|PACid:22645384
Sequence length 232
Sequence
MEVCTDLSLATPCCAQSENQVQDKLSTELNLFDPTWTKLKRTAEDDTAFASNPEHETLSA
TGNAMQKFMKRRNEVAAKISRLLIKYSFNEAVQQIWKGPTNSSRYMEPWPIKKTLTMTDV
GRNMHRARRLVLRRKLVKKHILPYLSYQIINCVENQGAGITIYDLNTCSEHQLIFKRWKG
SGTYVLMSAWSREFVWRRQLKEGDLIGFCWDAHKLMLVFSVIMRAGSXYPSA
Download sequence
Identical sequences MDP0000123473|PACid:22645384 MDP0000123473 XP_008360720.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]