SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000123668|PACid:22668503 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123668|PACid:22668503
Domain Number 1 Region: 144-181
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000126
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000123668|PACid:22668503
Sequence length 188
Sequence
MARRTAAGVEGLPSTASVNAVESSGCTDAAVPAANNNQGEKDDLYHQLWHACAGANVYVP
RPGEKVFYFLQGHMEQVEAYANQDCKMEMPRYNLPSKILCNVVCVQLKAEAHTDEVYAQI
TLLPVTEEDQVRAEEENTPPLPRRTSTRSFSKVLTPSDTSTHGGFSVPKRQADECLPPLV
GILVFPSK
Download sequence
Identical sequences MDP0000123668 MDP0000123668|PACid:22668503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]