SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000124051|PACid:22654473 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000124051|PACid:22654473
Domain Number 1 Region: 21-236
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.99e-18
Family FAD-linked reductases, N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000124051|PACid:22654473
Sequence length 236
Sequence
MDSRTKTPPHDYFRCRSSLRQVLDYITVGGGTAGCPLAATLSEKFLVLLDGVYNFRGRVL
GGGSAINGGVFSRASEDYVEKVGWNKMVLDAYKWVEYRNAFKPKLTPWLYVAELSFLEAG
IFPYNGFSLDHIGGTKIGVTTRDERGRRNTSADFLAAGNPNYITPLLSAAVSSAIFHKKE
AVARGIRFIKSDGSSSQTYEAYLNPRKNSRSSTGDVILAAGALGSPQILLSSGIGP
Download sequence
Identical sequences MDP0000124051|PACid:22654473 MDP0000124051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]