SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000124774|PACid:22657498 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000124774|PACid:22657498
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-23
Family B3 DNA binding domain 0.00093
Further Details:      
 
Domain Number 2 Region: 227-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000129
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000124774|PACid:22657498
Sequence length 385
Sequence
MAKEARNVRSPHFFAFYSADLSSERLKIPDRFMRHMEGRTSGLVLLFGPSGSAWSVELIQ
QNGGLFLHHGWPAFVRDHYVECGDFLVFRYDSDLCFTVLIFDQSACEKEAAFRFGYGQDS
SNFEKCMXVGRKRGMEEAASSGNKPVDGAXKKMRHGLSQLQSECIDEGQEEATCSKETNP
HENPGLDVVPNAAKASIQNVCGKGDGLNVNGRVCMQMSSAHEVAPVFSSSNPYFVRIIKS
FNISGSYTLNIPYKFSVAHLPNCKVKIVLQNWKGESWTVNSVPSTRVHTSHTLCGGWMAF
GETSSWLSPGLAVTTHKTIKGLSKKIKGNSPKVHSKSIREIADKLSSKMYQDAAFINDTR
KYGSSSRSLTKVALSQSKVASKKLX
Download sequence
Identical sequences MDP0000124774 MDP0000124774|PACid:22657498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]