SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000125043|PACid:22648273 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000125043|PACid:22648273
Domain Number 1 Region: 2-65,158-205
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-24
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 47-150
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.26e-23
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000125043|PACid:22648273
Sequence length 237
Sequence
MVTIEDGRNFIADAAIITVPHGILKAKLIEFVPQLPEWKVAAISDLGVGNENKVALRFEK
XFWPNVELLGIVAPNSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLTDDAAVNFVML
QLKKMLPDATEPVQYLLSRWGTDLNSLGCYALDLVGKPGDIYERLRAPLGNLFFGGEAVS
MDHQGSVHGAYSAGVMAAENCQQHLLKKLGNLEXPQHAYLMEEVLEAATVPLQISRM
Download sequence
Identical sequences MDP0000125043|PACid:22648273 MDP0000125043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]