SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000125949|PACid:22671191 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000125949|PACid:22671191
Domain Number 1 Region: 17-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 228-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-18
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 420-502
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 4 Region: 613-696
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000294
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000125949|PACid:22671191
Sequence length 729
Sequence
MASFHRKIHDFSSKTHLKAPHFLVVIPKSICTQTKLRIPNKFFRKYGDDLSNPVFLKLPT
GSEWKIELRIWEGEVWFGEGWPKFSKFCSLDCCHSLVFGYEGNSTFRVSVFDKDFTEINY
PLTMPEMEETDEDDDSDNSSWDDDDDSDCVEVLDNIMSRSRKTRDKYPLSCPQPRKKHRT
SSTAEFASKRHGEGTSSTPKRAQTVLGRMHASNARGKAAVALRRATAFKSDNPSFIVPMK
XTYINGYSVWLPSKLCIHMRRLGKHPGAITLRVLDGGTWSVEMKCEKATRPKLRLQYGWT
EFVRGNNLEVGDVCVLVLIDDTKLEFEVVIFRATETAHTFSPPDVDGEQTMSQMEETDED
DDSIEILDXFPXCXKTKKKSPXAPQPHKKNRTCSVSTAENRIKKFGGSSLTXKIMNRRTL
QYLGAKFTKEHFLKWNYHQVILRVSDGRTWPVKLSKRQKNMVRLQNGWITFVQDNHLEIG
DVCVFALINNIKGLMDVVIFRTTEAARWNLSQDVDGEKTMSETEETDEDDGCVEILDDSP
PCLKTKKKSPIATQPHKKNRAGSISTSENHMKKFGGSSCTKELVKRRPNQVPRMMNPLTE
SGTNRALQRARAFKSEYPCCMVVMRPSYIQANTLNLEAKFAXEHLLNRTHDNVILRVSGG
RTWPVKLHQYSKTVLKFQSGWMTFVQDNGLEIGDSFSAVEKXLIAPFHXVSKFSVGCEFL
SAPSGLSSA
Download sequence
Identical sequences MDP0000125949|PACid:22671191 MDP0000125949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]