SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000126738|PACid:22651879 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000126738|PACid:22651879
Domain Number 1 Region: 15-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-19
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 225-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000112
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000126738|PACid:22651879
Sequence length 284
Sequence
MAFLPEEIDDRPTFPPAVPHFFKIILNDTSRDKKIKIPPKFVTKYGDNMSXPVFFKVPSA
LEWKIELRKWDGEVWFENGWQDFSSFYSLDYGHLLVLGYERNSKFRVLILERSCTEIEYP
LQNTAEKTDEDEKSGDDSHDISXHESGDDLDVGSVEIXENHTPCPRKTREKSLLKPIGKV
LSSTSQEKQTKFTCLSRNTLTGLLVMSSFGFWVEELGVSNSNNTTPEDCRLLGGWKQFVR
ENSLAIGDECWIGFVRPPQQPSWSCLRLAETLEKREIPRWPNKA
Download sequence
Identical sequences MDP0000126738|PACid:22651879 MDP0000126738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]