SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000127640|PACid:22634716 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000127640|PACid:22634716
Domain Number 1 Region: 419-522
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.5e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000127640|PACid:22634716
Sequence length 987
Sequence
MLGSGSCSENDNPDPKPTPSGETGWRDGLSTVDAQSLGLYLYASDTPTSSLYRARRRTLC
RFWAVSRVGFGEFEFGAMDSKICMNPSCRTANTHEWKKGWPLRTGGFAHLCYKCGCSVVD
TELGGHYGIWVVVLDVGVEYENSVYCNTFHSGETGWRDCNLCHKPLHCGCIVSETLYECL
DFGGIGCIGCASQPRVIQNDDVLNGFGGLKISNSGDQQSTVPQNGALSDTANEGKLLQLC
QVMEANESNLSSQSQRGDINVSPVQSKQEEVTYPKGEVGPGFSSITRPSIGSLTFAKPDN
GRIMIEVKDMNNPSSEPSLSMTLGGPSATPNFAQPFTGGILEGRDKSKMPSSFQQGQKIR
PILPRPLRPPSPVHHVRVARPPSEGRGKSQLLPRYWPRITDQELQKLAGEYPYLNSTIVP
LFEKVLSASDAGRIGRLVLPKACAEAYFPPISQSEGLPIRIQDVKGNEWTFQFRFWPNNN
SRMYVLEGVTPCIQSMQLQAGDTVTFSRIDPGGRLVIGFRKASRSLDMQDPQTSFLPNGT
PGETSCPSVVENLVTGSGQSSIYQTNTGSKDPYLNALSGHLHLAXGDTSLHNCENHSHLT
SEDLLQRPVSNSDKKRARNIGPKSKRLLLHREDVLELRLTWEEAQDLLRPPPSVKPSIVT
IEDHEFEEYDEPPVFGKRSLFIAESERQEQWAQCDDCFKWRRLPVDVFLPPKWTCSENSW
DMNRCSCSAPEEVSQKELDNLLRPSIDLKKRRIVVNHNEAQEXEPSGLDALASASAAILG
DSVDYSGEQSLGATTRHPRHRPGCTCIVCIQPPSGKGKHKPTCTCNVCMTVKRRFKTLMM
NKRKRKSEREAENAQRDNNDHKDESEMNGTSTEIELHRNHSSENGGSSEKRIEADVAESS
CAGQIDLNCEPKHNYVQVSGLNLLRLADAVARQPVNNGTRESFLTNKTCEPQAGLGSSLL
AQETAETDRLMCNEGSLSSVAALDFGG
Download sequence
Identical sequences MDP0000127640|PACid:22634716 MDP0000127640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]