SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000129765|PACid:22673448 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000129765|PACid:22673448
Domain Number 1 Region: 7-188,303-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-40
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 192-307
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-27
Family PHBH-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000129765|PACid:22673448
Sequence length 428
Sequence
MSLKKKPKAVIVGGSIAGVSCAHTLVLTGWNVLVVEKSCAPPTGSQTGAGLGLDPLSLRL
IQSWIQDPELLHQTTLPFTIDQNAXDAYAKNDAIDGEKKVKWTLTRDEELNCRAGHWGDL
HALLYNALPPNLFLWGHRFLSFSISSDKSSVIVKASSHETNEXIEIIGDLLIAADGCLSS
IRQSFVPDHKLRYSGYCAWRGVLDFAGNENSETIIGIRKEYPELGKCLYFGLGSGTHTVL
YELPNRRLNWIWYVHQPEPDLKPNSMTMKASSDMIQSMHKEAEKMWLPEFVRVIRETKEP
FINXIYDSDPLEKIYWDXVVLVGDAAHPTTPHALRSTNMSVLDAAVLGQCLKKWGAEDLQ
FALEXYQSIRLPVVRKQVLHARRMGRIKQGLVLPDRQLSNPETANPEECHELQQKLMPFF
TDVPSILL
Download sequence
Identical sequences MDP0000129765 MDP0000129765|PACid:22673448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]