SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000130099|PACid:22624356 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000130099|PACid:22624356
Domain Number 1 Region: 30-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.75e-47
Family FAD-linked reductases, N-terminal domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 322-489
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.14e-32
Family GMC oxidoreductases 0.000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000130099|PACid:22624356
Sequence length 552
Sequence
MVKSMVFRVLLVLQLCVHLQSEVQSLATPSEHDFSYSKSVVNATDLPQEEVYDYIVVGGG
TAGCPLAATLSLNYSVLVLERGSFPASYPNVLTQDGFIYNLQQEDDGETPVQRVMSEDGI
PTVRGRILGGTSIINAGVYARANISFFSQSGVEWNMDLVNATYEWIEDTIVYKPNAFAWQ
TITQQAFLEAGVLPDNGFSLDHVLGTRITGSTFDNNGTRHAADELLNKGDLDNLRVAVHA
NVEKILISSTFESNLSARGVIFKDSNGISHRSYVRNQGEVILSAGTMGTPQLLLLSGVGP
ESYLSSLGIPVVIDHPYVGHFLYDNPRNFINILPPNPVEASIVTALGIRNNFWQCSISGG
PLTVPPYSFFPSQSYPLPNSTFLHIPNKVPGPLSHGSLTLNSSNDVTVGPNVVFNYYSNA
TDLAHCVSGMKQFSDLLRTDAFKPYKTEDLPGVEGFTFLGVPFPNNQTDDALETFCHDSL
ASYWHYHGGCIVGKVVDGGLRVSGIDALRVVDSSTFPVTPASHPMGFYLMLGRYMGLQIL
QERSPWIGISSA
Download sequence
Identical sequences XP_008353712.1.92800 XP_008353713.1.92800 MDP0000130099|PACid:22624356 MDP0000130099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]