SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000130369|PACid:22663416 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000130369|PACid:22663416
Domain Number 1 Region: 52-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.68e-28
Family FAD-linked reductases, N-terminal domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000130369|PACid:22663416
Sequence length 353
Sequence
MSLAACWRLTLTCPXPTSSRTSSCFSPRSRSGFRCRASSGQAHAAIGGPNDKEKKKVVVV
GSGWAGLGAAHHLCNQGFDVTVIEQGSGLGVLHEIGIQRGNWYPFRNIFSLVDELGIKPF
TNWTKFAQYSAEGLEIELEVLKCVNGGSNVLQAEFPVFQDLPQLPAPFGTLYYTQFAQLP
LVDRLTSLPLTAAVIDFDNTDTAWRKYDAITARELFKQFGCSENLYQNVLSPLIQVGLSA
PAEQCSAAATLGLLSYIFAHQKNFDLVLCRGTSRERIFKPWMESLTTKGCKFEKGMQLTD
FVLNEETGSISEVVCNGGVYNADAVVLAIGISTLQKIIENSNNVTTALKLQHT
Download sequence
Identical sequences MDP0000130369 MDP0000130369|PACid:22663416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]