SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000131481|PACid:22630798 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000131481|PACid:22630798
Domain Number 1 Region: 93-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000131481|PACid:22630798
Sequence length 773
Sequence
MAGTKATRVGPNPMGRTMKESEKSLDPQLWHACAGGMVHMPPVNSKVFYFPQGHAEHAQS
GGGVDFSAASLRIPSLVLCRVAAIKFMADPETDEEKPASFAKTLTQSDANNGGGFSVPRY
CAETIFPKLDYSADPPVQTVIAKDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVA
GDSIVFLRAENGDLCVGIRRAKRGLDGGGGNEVASGWNNSHSSGGGSGGCVLPYGSFCVF
LREEDNKMRNGGGNLSPNGNMRGKGRVRPESVVEAATMAAKGQPFEVVYYPRASTPEFCV
XASAVRAAMREQWCSGMRFKMAFETEDSSRISWFMGTVSSVQVANPICWPNSPWRLLQTW
HCRPXGLKLALWELRTHLVVHILLGHSXNYLRSVVYLNSVTLLKSCHLIIWLDIDXQTTI
LQVTWDEPDLLQNVXCVSPWLIELVSNFPMIHMSPFSPPRKKLRLPQHPDFSLDGQLTLP
SFSGNPLGPSSPLCCLPNNTPSGIQGARHAQFRISLSDLHLNNKLQSGLFSSSFQRFDQS
SRISNGIRAGHTSSNENLSCLLTMGNSSQNSEKPDNVKKHKFLLFGQPILTEQQISRSCS
SEAVSQLLPGKNSKDGSQDKTXFFFNGSESVLGRQVXLEKSTSAGFSWNKDFQATDLDLE
TGHCKVFMESEDVGRTLDLSALCSYEELYRRLANMFEIEKPEMMSHVLYRDVTGAVKQTG
VEPFSDFMKTAKRLTILTHPASESIGRTWIRGMQNAENGLGATXKTGPLSIFA
Download sequence
Identical sequences MDP0000131481|PACid:22630798 MDP0000131481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]