SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000134271|PACid:22620865 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000134271|PACid:22620865
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.5e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.09
Further Details:      
 
Domain Number 2 Region: 14-55,330-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000679
Family FAD-linked reductases, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000134271|PACid:22620865
Sequence length 542
Sequence
MAAANTHHLHSVSKVGIIGAGISGIAAAKQLSGHSPVVFEATNSIGGVWRHCSYNSTKLQ
TPRCDFEFSNYPWAERDNSSFPSHVEVLEYLHGYATHFDLLKYVKFESKVVEVRYVGGIG
HQTTTQFPGNSNSXEYGNLLNGDPVWEVAVQMCSNPNTIQWYAFEFIVVCIGKYGDIPRM
PNFPRNKGQEVFQGKVLHSMDYSKLDQQAARELLKGKKVAVIGYKKSAIDMAVECAEANQ
GPDGQACTMVIRTLHWTVPSYWIWGLPFFLFFSTRSSQFLHERPNQSLFRALFCLLSSPM
RMAISKFIESYLKWKLPLVKYGLKPDHPFLEDYASCQMAILPENFFAEADKGKILFKKSP
KWXFWSGGIEFEDNTKLEADVVLLATGYEGKQKLQSILPEPFRSLMVDSSGTMPLYRGTI
HPLIPNMAFVGFIESVSNLHTAELRCKWLGRLVDNEFKLPTVQKMLEQIGREMEVMKNXF
TRGTAFQLSVSTTATTFVKRWDGNLGGKVTGFQKLLAPITAETTKKLTIEPXHVLLRYKX
XE
Download sequence
Identical sequences MDP0000134271|PACid:22620865 MDP0000134271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]