SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000134824|PACid:22673229 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000134824|PACid:22673229
Domain Number 1 Region: 124-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-41
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 1034-1099
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000108
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000134824|PACid:22673229
Sequence length 1134
Sequence
MKPPANGAGASDASCASNSCQGXANVKSINPELWQACAGPLVNLPPAGTHVVYFPQGHSE
QVAASIKKDVDGQIPNYPNLPSKLLCLLHNVTLHADPETDEVYAQMTLQPVSSFDKDALL
RSDLALKTNKPQPEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELVARD
LHDAVWTFRHIXRGQPKRHLLTTGWSLFISGKRLFAGDSVLFIRDEKQQLLLGIRRANRQ
PTNLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKAACGNQ
LSLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVNVMATSRCISSLVT
SGHLVGHVGWDESTAGERRNRVSVWEIEPVTAPFFICPPPFFRSXRPRQPGMPDEDSDMD
SLFKRTMPWLGDEMSMKDPQVLPGLSLVQWMNLQQNSSLGNSMQPNYLHSYSGSAMQNLN
GADLSQQLGLLAPQIPQMNNLQFNGQRLPQQVQQLDQLPKLSSSTSPLASMMQCQQQLGD
NSQQPRQNSVNQTLPSSQVQSQLLQPPTLVHNNGGILQQQSSSQNHLQRNLPQNLQQHQQ
QFAAQNQQQSFIQSQPPDQMNQQLQHLSDNQLQFQLFQKLQQQQQSLLAQQALQQPGQLV
QLQDQQRQMFDVSQSFSRPSPTQMLDMPQMAQTSHPQSRTMPQQMTKNNNSQANSRFSHS
PQQPKLQQQQPGXLPEMSGHMGHLPNPTTNQFSTAASNMMTGVAXAGXSGITDEVPSCST
SPSTNNGPSVIQPLMNNKAHRNSSIGEDMALSATAILSSGAINTMPWHGNLMKDFQHKSE
VKPSVNIARNQSXGILTPQAYMSGAAAHTDYLDTSSSTTSVGLSQNDVHLQQNNAPLPFH
PQSTLFRDASQEVEVLADQRNDVLYGSNIDVQLGIPLNPDPMLAKGVVGLAKDFSNNISS
GGILGNYENSKGAQPELSSSMVSQSFGVPDMTFNSIDSAINDSXFLDSGPWAPAPPLQRM
RTYTKVYKRGAVGRSIDMTRYTNYDELKQDLARRFGIEGQLEDRGRVGWKLVYVDHEKDV
LLVGDDPWEEFVNCVRCIKILSPQEVQQMSLDGDFGGNAVLPNQACSSSDGGKA
Download sequence
Identical sequences MDP0000134824|PACid:22673229 MDP0000134824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]