SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000135105|PACid:22644644 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000135105|PACid:22644644
Domain Number - Region: 134-157
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.049
Family B3 DNA binding domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000135105|PACid:22644644
Sequence length 526
Sequence
MVAIAATTYEEARNQRLEENKRKFQDLGISSISKTLTHLTASPNKTQHRVSKPKARNACL
DIEPRRSSRQRNSVQTYRDDVDIDLPPLRKRSRSSSSFCGSYLARPMEEVRLCSYEERQA
ALKAAEKLLENLQTDNPSFVKTMVRSHVYSCFWLLLEXFVLISRVFPQDFVMNISQKRAQ
IWCWRMXMATSXXLSTLAXELGLVGAGERLHWNTSWMMIYIVKVSSMSSIKSIVDKEDIP
SAENTSKTAVKRDSESTQKRRTKRGSVSEIDDSQPSPGSESDQRRRSKRGIVPPTDDAKA
ATDLESNQIRRSKRGAAPVADDSKTNFNSESNQLRRSKRGAAPVADDSKMNFNSESNQLR
RSRRGTVPVADDSKTNFNSESNQLRRSRRGTVPAMDDTKASPDLGSDQKRRSKRGVVPEM
DDLEASPKLPTEXPKGCETEQEACAMKVDEVAPKQVRKKAKANRVCFTESPEGCEVKPEE
TEEKPEVPEKKPKVEEKNARAKVENECVAKKPRKKVVKQRLFRKRA
Download sequence
Identical sequences MDP0000135105|PACid:22644644 MDP0000135105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]