SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000135231|PACid:22629791 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000135231|PACid:22629791
Domain Number 1 Region: 74-155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000162
Family FAD-linked reductases, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000135231|PACid:22629791
Sequence length 181
Sequence
MAAASXXLSHPKPHTNDAVSSLRSHFKPSSFASXSTSFGSSKFASKXLSLRTAATRSGRP
EPATLSHSESRSDQTFDVLVIGAGIIGLTIARQFLIGSDLSVAVIDKSVPCSGATGAGQG
YIWMGHKTPGSDLWDLGLRSQKLWEELAESLIEQGLDPLQLLGWKKTGIFCVSKARSLLL
L
Download sequence
Identical sequences MDP0000135231|PACid:22629791 XP_008356684.1.92800 MDP0000135231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]