SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000138163|PACid:22622470 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000138163|PACid:22622470
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-30
Family B3 DNA binding domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000138163|PACid:22622470
Sequence length 440
Sequence
MEFMQRDQKGYSDKEDQDQEQEDQEEEEDIITTSKFSSSSSHTSNNSNYGSSPKYKAILF
PPPPDHHQQYGQQKPRLNIQNHGSPEATNFMDLSLNKXIQAAEGGTNEXYWPASCEREHM
FEKVVTPSDVGKLNRLVIPKQHAERFFPLDSSSNDNGLFLNFQDRTGKPWRFRYSYWNSS
QSYVITKGWSRFVKEKKLDAGDIVSFERGVGESGKDRLFIDWKGRPPPPPPPRLHHHNHY
AGGRFCSLLQRPPPSSVISSMPLRHHEHFLHSNNNIHHPYHHHHHNHQIMNQQYLPHQIH
QLQGGRGHHVIHHQYPXVIDSVPLYQHANYRSSTTSTSSESASVASAGKKLRLFGVNMEC
SSSPTEKEDHQECQILSSTAIPYHHHHHNLPSSTSSLASAPFQFMRLPNTSSTSSTPPDH
HFLSNKGKSTTTSLSFYLNP
Download sequence
Identical sequences MDP0000138163|PACid:22622470 XP_008376241.1.92800 XP_017188567.1.92800 MDP0000138163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]