SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000139073|PACid:22644421 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000139073|PACid:22644421
Domain Number 1 Region: 104-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-40
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 615-689
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000186
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000139073|PACid:22644421
Sequence length 722
Sequence
MANREGGDLYPELWKACAGPLVDVPRVQERVFYFPQGHMEQLEASTPTNQELNQGIPQFN
LPSKILCRVVNVTLLAEQETDEVYAQITLIPDVNQTDPTSPDPCLPEPQKPAVHSFCKVL
TASDTSTHGGFSVLRKHATECLPALDMTQATPTQELVAKDLHGYEWRFKHIFRGQPRRHL
LTTGWSTFVTSKRLSAGDSFVFLRGGNGELRVGVRRLARQQSSMPSSVISSQSMHVGVLA
TASHAVATRTLFVVYYKPRTSQFIIGLNKYLEAVNNKFSVGMRFKMRFEGEDAPERRFSG
TIVGLEDISPHWADSKWRSLKVHWDESASIPRPDRVSPWEIEPFVASVLPSLPQPAVVKN
KRPRPPTEIPALDAMSSTGSAMWNSGLTQSHDTSTLSVAAEGKRSENHVVWHHQQADVIS
NNNSVPRTQIDGGWLSSQAGGSPHRFQETMEDSKSVSAWPVYSGYSTSNSSKPKNDSMFD
HVEKEKKTETGTSCRIFGIDFTSHSTCFPAMEKAHPQPISGPTGTTEGRVSNPSAAESDQ
KSDLSKASKESKPGQLQLSPKETQSKYSCSTSARSRTKVLKVELFLIVFYSEISSIHVID
LESLAQVLSCGVCISQKVQMQGIAVGRAVDLTMLEGYDQLIDELEEMFDIKGQIRPGNMW
QIVFTDNEGDMMLMGDDPWSEFCDMVKRIFICWSQDVKKISAGCELPLSSLEVEGGTVIS
SD
Download sequence
Identical sequences MDP0000139073 MDP0000139073|PACid:22644421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]