SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000142434|PACid:22683351 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000142434|PACid:22683351
Domain Number 1 Region: 9-169,275-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.25e-47
Family FAD-linked reductases, N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000142434|PACid:22683351
Sequence length 407
Sequence
MEVGDEEIGIAIVGGGICGLATALALHRKGFTSVVLERSESLRATGGGITIRANGWRALD
ELGVASKLRQTALPLQGARDIYXHNGKQQKISYGGAEARCLKRSDLITTLAESLPVGTIR
LGCQAISVKLDSLTSYPTLQLHNGSTIKAXVVIGCDGTKSVVADFIGVKPSKPFMLSEVR
GFTVYAGGHNFGNEFVQVKGDKNTIGRLPVHDNLVYWFVSHQVHGGQADPSKVSKDPELI
RQFTLQSILEEFPSEIVDMIRKSELESVSHVRLRYRPPWEIVVQNFRKGSVTVAGDAMHV
MGPFIGQGGSAGIEDAIVIARSLAPALAKNYYKKWSGRNGMMVEVGEAFDKYVKERRMRL
VMLSTQTYLLGLLQQDSGSMLKFVCLILMATLFSDVIRHTRYDCGRL
Download sequence
Identical sequences MDP0000142434 MDP0000142434|PACid:22683351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]