SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000143207|PACid:22656792 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000143207|PACid:22656792
Domain Number 1 Region: 111-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000161
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000143207|PACid:22656792
Sequence length 291
Sequence
MKQVFVTQTPIARLRCSLLEGCRLPYPTKPRSKHRINSINQKLSLASNNATTTQSHHHHH
TNNVSLKRKCDRIDDVDDGDNDQDRGAAEKKKAKFLNNRDDNVNLNMKKKRKSLTVMDID
GRQGRLLLPRQQTESKNFLKRNAMDRLKKDKVMRVQLIDSKLEQVPISLGLWKMSSNSKT
EESDDPKRTYVLKSQWNHIVKKHGLGKGDVVQVWSFQAIPNDTENGSELHLANMQKGDDG
ELHLALVLVKRGDQVLEEEGSKGSLAIASTNGRSSSVCNNGASGSAVSHNM
Download sequence
Identical sequences MDP0000143207|PACid:22656792 MDP0000143207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]