SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000143319|PACid:22673778 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000143319|PACid:22673778
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000785
Family B3 DNA binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  MDP0000143319|PACid:22673778
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00171
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000143319|PACid:22673778
Sequence length 173
Sequence
MEKNLSNPVHFKLPSGAEWEIEVTRSDGEVWLDKGWPEFSRVFPSFLSFTPLDYGDCLVF
RYEGNSKFHVCIFDTCATEIEYPLPCPEMEEADEDDDESVEILEDFPPCPKTRQKSPLPS
PLPHKKKRQALLQRAIDSKSEKPHFKVAMQPSYIXHQLXLPLAFAKRHLMQRL
Download sequence
Identical sequences MDP0000143319|PACid:22673778 MDP0000143319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]