SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000143749|PACid:22644960 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000143749|PACid:22644960
Domain Number 1 Region: 127-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-47
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 775-861
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000405
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000143749|PACid:22644960
Sequence length 896
Sequence
MMGSVEEKLKTGCLLDEMKLLKELQDHSGTRKAINSELWHACAGPLVCLPQVGSLSYYFP
QGHSEQVAVSTKRTATSQIPNYPNLPSQLLCQVQNVTLHADKETDEIYAQMSLKPVSSER
DVFPVPDFGMRPSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDFTMQPPTQEL
VVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGAKRLRAGDSVLFIRDEKSQLLIGVRR
ANRQQTTLPSSVLSADSMHIGVLAAAAHAAANRSPFTIFYNPRACPSEFVIPLATFQKAV
FGTQLSIGIRFGMVFETEESGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCCDK
QNRVSSWEIETPESLFIFPSLTSSLKRLMHSGFLGAETEWGNMTKRSFIRVPEIGNGNSF
PYPISNLCSEQLVNMLMKPQLVNHAGTLATLQQESAANVDSVDMKAMQAKINQKNPADGV
NANAPSHGIPPGNLNTVAKFGSQAPVGSSTEKMKSEPELSADQLSQLSSAGQGIEDKLAA
GFASPYNHMNQLTFANQNPSSAQLQTSPRPMQPLDSLLYHSQQTELPHSDFNGMNSSLPF
LDNDECMFYSSCLPFSGALRSPGPLSAFGLPDSSTVLTDANTSSLTSIGQDMWDNSLINS
SSLRDLSDESNNQSGIYGCPNIDVGSCLSTVVDPSVSSTILDDFSTLKNANFQNSSDCLV
KNLSSSQDLQSQITSVSLGDSQAFSRQDLADASGGTSSSNVELDESSLLQNSSWHPVVAP
VRTYTKVQKTGSVGRSIDVTNFKNYEELCSAIECMFGLEGLLNDPRGSGWKLVYVDYEND
VLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGMNSTMSEGGRP
Download sequence
Identical sequences XP_008387956.1.92800 MDP0000143749 MDP0000143749|PACid:22644960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]