SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000145663|PACid:22632174 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000145663|PACid:22632174
Domain Number 1 Region: 77-240,335-460
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.54e-33
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000145663|PACid:22632174
Sequence length 496
Sequence
MATLLRPFPXPPSAAKTSQFFHSSSLPHHFSRTDYPSPNKSLSKIHSSKFGNFLDLKPEA
KPESLHFDLHQFDPSTRSRLDVIIIGTGPAGLRLAEQLSRYGIKVCCVDPSPLSMWPNNY
GVWVDEFESLNLESCLDKIWPMASVHVNDSKIKFLDRPYGRVSRKKLKTLLLERCLXNGV
QFHRAKVWKIEHEEFESSILCDDGNELKASLIVDASGFASSFIEYEKPRNHGYQIAHGIL
AEVEEHPFDLDKMLLMDWRDSHLGNEPYLRTSNSRFPTFLYAMPFDSNLVFLEETSLVSR
PVLSYMEIKKRMVARLRHLGIRVKRVIEEEKCLIPMGGPLPRIPQRVMAIGGTSGVVHPS
TGYMVARTMALAPVLAEAIAECLGSTRMIRGQPLYHRAWNGLWPIERRCTRDFYSFGMET
LLKLDLNGSRSFFDAFFDLDPYYWQGFLSSRLSLRELALLSLSLFGRASTPSRFDIVTKC
PVPLVKLMGNLALEAA
Download sequence
Identical sequences XP_008361015.1.92800 MDP0000145663|PACid:22632174 MDP0000145663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]