SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000146397|PACid:22625573 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000146397|PACid:22625573
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-21
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000146397|PACid:22625573
Sequence length 214
Sequence
MASLRPTFSSTIPHFFKVILDDTSRDTKLKVPMKFVMKYGEELSSPVYLRLPCGSEWEIE
LRRCNGEVWFEKGWPEFSKFYSLDYAFWLVFGYEGNSRFHVFIFDRSCTEVDYPIKLPDK
EKTDYEDDESVEILDDFPTSRRRKGERYSSLPCPLPPKKKRKSYSRMHPLTEKDKAIALQ
RAIAFKSEKPHFKVAMQPSYIFGNLVNTLAQVII
Download sequence
Identical sequences MDP0000146397|PACid:22625573 XP_017180135.1.92800 MDP0000146397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]