SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000146434|PACid:22625975 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000146434|PACid:22625975
Domain Number 1 Region: 177-399,520-567
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-71
Family Tandem AAA-ATPase domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 569-677,756-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.73e-41
Family Tandem AAA-ATPase domain 0.0000253
Further Details:      
 
Domain Number 3 Region: 879-1025,1092-1174
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.75e-36
Family Helical scaffold and wing domains of SecA 0.0013
Further Details:      
 
Domain Number 4 Region: 398-519
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 9.94e-35
Family Pre-protein crosslinking domain of SecA 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000146434|PACid:22625975
Sequence length 1177
Sequence
MAKVKRDPCKEHNIGDDDDDDLDCFCLPTLIWACYFALGAQCRGTAKWCNGMMMTGVVVR
FMVLQCLHSFHVAGRIVADRFPLPTRLLHLHIAERAPXLWLPCLLSKTPISYPLNLSHNS
PPPSSPTKPASFLRFLPSLSFVFTFSRPPRRRLRLTXKPIAASIKENLGLIRKTWSDVTS
LNNWVVRDYYRLVKSVNALEPQVQSLSDDQLTAKTAEFRQRLGKGETLADIQAEAFAVVR
EAAKRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVN
DYLAQRDADWMGRVHRFLGLTVGLVQRGMTAEERRSNYSCDITYTNNSELGFDYLRDNLA
GNSGQLVMKWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDAARYPVAAKVADLLVRG
IHYNVELKDNSXELTEEGIALAEMALETNDLWDENDPWARFVMNALKAKEFYRQGVQYIV
RNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVVAQITYQSLFKLYPKLS
GMTGTAKTEEKEFLKMFQVPVIEMPTNLPNIRNDLPIQAFATAQGKWEYVRQEVEYMFRQ
GRPVLVGTTSVENSEYLSDLLREQNIPHNILNARPKYAAREAEIVAQAGRKYAITISTNM
AGRGTDIILGGNPKMLAKEIIEDSLISFLTREAPNVDVDGEAISQKVLSKIKVGPSSLAF
LAKTALMAKYVCKNEGKSWTYKEAKSMISESVEMSQSKDLKDLETLVDEQSEMYPLGPTI
ALAYLSXLKDCEVHCFKEGSEVKNLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRF
MVSLQDEMFQKFNFDTEWAVRLISKITNDEDMPIEGGAIVKQLLALQVNAEKYFFGIRKS
LVEFDEVLEVQRKHVYELRQSILTGDDESCSQNIYHIFVLINSLKVVNRYMQAVVDEIVF
GNVDALKHPRNWNLGKLLKEFMTISGKLLDASPDSFTGITEEVLLKSLADSHELNSRNIH
DVHLPNLPRPPNAFRGIRKKSSSLKRWLAICSDDMTKNGRYHATTSLLRKYLGDLLIASY
LDVIQESGYDDGHVKEVERAVIVKTLDCFWRDHLVNMNRLSSAVNVRSFGHRNPLEEYKI
DGCRFFISMLSATRRLTVESLVQYWSSSMESQEIFVS
Download sequence
Identical sequences MDP0000146434|PACid:22625975 MDP0000146434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]