SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000148978|PACid:22620687 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000148978|PACid:22620687
Domain Number 1 Region: 92-144,266-314,352-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-28
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000148978|PACid:22620687
Sequence length 546
Sequence
MAQWACVSAANLSCQATIVNTQKQRNSPGCDAFSFKGSEFMAQSCRFSSPQAVYRRPRNG
VCPLKVVCVDYPRPDLDSTANFLEAAYFSSTFRASPRPTKPLKVVIAGAGLAGLATAKYL
ADAGHQPILLEARDVLGGKDGGLGIIELSAFDQTLLSVGGGVCVGMGDVLSDRWQHGKIV
MGTGMKQACIYSERMMECNSVTNLGMRFLVVSSLHYSPSSVWFKVQTVPGKFKVAVPNIL
GVRTPGFPASVFIVIFCPRWIYIIYTLLNETGFGAYPNIQNLFGELGINDRLQWKEHSMI
FAMPNKPGEFSRFDFLEVLPAPINGKYYSHLLKIESSLFTNAENSFCSWEGIWAILKNNE
MLTWPEKIKFAIGLLPAILGGQAYVEAQDGLSVKDWMRKQGIPDRVTTEVFIAMSKALNF
INPDELSMQCILIALNRFLQEKHGSKMAFLDGSPPERLCAPIVDHIQSLGGEVRTNSRIQ
KIDLNNDGTVKSFVLNNGSVIEADAYVFATPVDILKLLLPENWKEMPYFKKLEKLVGVPV
INVHIW
Download sequence
Identical sequences MDP0000148978|PACid:22620687 MDP0000148978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]