SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000152089|PACid:22663193 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000152089|PACid:22663193
Domain Number 1 Region: 119-208
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000159
Family B3 DNA binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 13-58
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000477
Family GCC-box binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000152089|PACid:22663193
Sequence length 253
Sequence
MEQMVQVQTSCMPFSRWGAQIYGKSHRVGLGTFNDEEEAAKTYDIASLKFRGLDAIINNS
RNKMKPYERDVTEALFLESHSKAEIVDMLRKHSYANELEIYNVWKHYLDLRDTCSSGREL
LFEKVATPSDVGGLNRMVIPNNMPRSIFRMRWGKCGGLDIVIGVVVRASYVLSKGWIFFV
KEKKLKVGDVVKFERSVGEDKKMFIYCRLRNLDMSGIREMHGRVGDPLRTVXDHGAVRLF
GVNISWKPVHCRE
Download sequence
Identical sequences MDP0000152089 MDP0000152089|PACid:22663193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]