SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000153538|PACid:22660264 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000153538|PACid:22660264
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 745-826
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000338
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000153538|PACid:22660264
Sequence length 887
Sequence
MRLSSSSSSPGFNHQLQEGEMKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAAS
TNKEVDAHFPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKDVYLLPAE
LGAANKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDN
EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVM
PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG
MRFRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWE
IEPLTTFPMYPSPFPLRLKRPWASGVPSFHGLKDGDMGINSPLMWLQGGLGDQGMQSLNF
QGFGVSPWMQPRLDASMAGLQPDVYQAMAAAALQEMRAVDSSKCSSQSLLPFQQSSSVSN
GAAAVLQRQVLPQSQPQNAYLESFQESQAPAQAQQQQQHQLQQSRHMHQLSVQHQIPNXM
SALPNFASITPSQSASMQSISSQPQQQSFPDPVGNPIPSSDVPPVHSMLGSLSQDGTSHL
LNLSGSNSAISSSLLAKQTTGEPQLSSGAAQCVLPQVEQLRTPQSSFSEITALPPFPGRE
YSAFQGGTDPQSNLLFGVNIDSSSLMLHNGIPNLRNIGNGNDSVSVPFGASNYASGTGND
FPLNSDMTTSSCVDESGFLQSSENVDQVNPTGTFVKVHKSGSFGRSLDISKFSSYDDLRS
ELARMFGLEGQLKDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVYYIKILSPLEVQQM
GKEGLNSVASVPNNKLSNGSNTTVDYVGRQDLRNSRNGIASLGSLDY
Download sequence
Identical sequences MDP0000153538|PACid:22660264 MDP0000153538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]