SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000153589|PACid:22644982 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000153589|PACid:22644982
Domain Number 1 Region: 162-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-27
Family B3 DNA binding domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 31-88
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000203
Family GCC-box binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000153589|PACid:22644982
Sequence length 311
Sequence
MDLMSCWNRSTRDYSTVIGAKAASSNKLPSSSYKGVVPQSNGRWGAQIYEKSHRVWLGTF
DDEEEAAKTYNIASLKFRGLDAITNFSPNQMTPYERDVTEALFLESHSKAEIVDMLRKHS
YANELEMYKHKLYNGGALGLDAGGKRMKCHLDLMDTCSSERELLFEKVATPSDVGRLNRM
VIPKQHAEKHFQVHLSVGFGKGVLLKFEDELGNVWRFGYCYWSSSQSYVLSKGWIRFVKE
KKLKAGDVVRFERSVGEDKKLFIDCRPRNVDVSGIREMHGRVGQPLGTAQDDGMVRLFGV
NIQPSTWPRYQ
Download sequence
Identical sequences XP_008379887.1.92800 MDP0000153589|PACid:22644982 MDP0000153589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]