SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000154720|PACid:22639222 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000154720|PACid:22639222
Domain Number 1 Region: 56-256,378-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.38e-49
Family FAD-linked reductases, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000154720|PACid:22639222
Sequence length 509
Sequence
MNSLIIRRNLAESIKRLKLSQRALCTDAAAKVSSSNGAQPGNGRVAQPIFSNKSNPYDIA
IVGGGMVGMALACSLAKMPLTKHLKVAIIDSNPAVSNGLSIKKEDPPDPRVSTVTPVTIS
LFKDIGAWKYVEQNRHAYFDQMQVWDYTGLGYTRYDARDVHKDSLGCVVENKVLHSSLLS
CMQNTDFQKTIYPSRLSTMTLQPRNLSMGVGSTSSGLNEQGNLAKLDLIDGNSLYAKLVV
GADGSKSRVRELAGFKTTGWSYSQNAIICTVEHSVENRCAWQRFLPAGPIALLPIGDNFS
NIVWTMKPKEATDRKLKAEDEFVKDVNYALDYGFGPHPGSSTSGGGGIFSLFTNANLSAN
DCFKVPPKVLKLVSERMVFPLSLMHANNYASKHVVLIGDAAHTVHPLAGQGVNLGFGDAF
ALSRIISEGIAVGRDIAEVSLLKKYEAERKSANVTMMAILDGFQKAYSVDFGPLNVIRAA
AFNGAQYFPPLKRSIISYASGDQRLPIFS
Download sequence
Identical sequences MDP0000154720|PACid:22639222 XP_008389891.1.92800 XP_008390506.1.92800 MDP0000154720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]