SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000155544|PACid:22633491 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000155544|PACid:22633491
Domain Number 1 Region: 63-161
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-22
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  MDP0000155544|PACid:22633491
Domain Number - Region: 358-406
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000155544|PACid:22633491
Sequence length 417
Sequence
MCGGLGFETHCCCGSQIYDQKEVVSANPKSNKRKRATVDSLYGTCQAPSSVLERAKEVEA
TLDXRFPVLLKVMLPSHVTGGFWLGLPKKFCCENLPKQDTMIVLEDESGEEFHTKYLVEK
VGLSGGWRGFSIAHNLLEGDVVVFHVLAPSKLKVYIVRSNGSDDLDGALGLMRLDACTKQ
MDTGDIIACEGEDSENLESIPDDNAIAFDTKSGLSSDHSGNDSENLDFEVLDGLRLSETV
VTFEEVNCMENFNVLVNGLNINSKFSKHILRKYYELCCSQNAFLHEQLIEGLNCKLVAGV
ISETVNIADAIRACKITTSKGNFSTWDTTLKAFDDLGMNVGFLSARLDHLTSLGLKSKRF
KEAKLEKDRAEEEKRNLEAKLTEVQNAIIRLASEMKTLNTSSEKLELMFQEVAKAPW
Download sequence
Identical sequences MDP0000155544|PACid:22633491 MDP0000155544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]