SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000155608|PACid:22665289 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000155608|PACid:22665289
Domain Number 1 Region: 7-179,302-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-32
Family FAD-linked reductases, N-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 128-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000872
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000155608|PACid:22665289
Sequence length 425
Sequence
MPLTKHLKVAIIDSNPAVSNGLSIKKEDPPDPRASAVAPATISLFQDIGAWKYVEQNRHA
YFDQMQVWDYTGLGYTRYNARDVHKDSLGCVVENKVLHSSLLSCMQNTDFQKTVYPSRLS
TMTLQPRNLSMGMESTSSGLNEQGNLAKLDLIDGNSLYAKLVVGADGSKSRVRELAGFKT
TGWNYSQNAIICTVEHSVENRFAWQRFLPAGPIALLPIGDNFSNIVWTMNPNEATDRKLK
AEDEFLKDVNYALDYGFGPHPKSSTSGGGSIFSWFKTDTNLSANDCFKVPPKVLKLASER
TVFPLSLMHANDYVSKHVVLIGDAAHTVHPLAGKGLIWGLETHLLYQESFVLLLKKYEAE
RKSANVTMMAILDGFQKAYSVDFGPLNVLRPAAFNGAQYIPPLKRSIISYALRGSKIANF
FLRRT
Download sequence
Identical sequences MDP0000155608|PACid:22665289 MDP0000155608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]