SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000157871|PACid:22670351 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000157871|PACid:22670351
Domain Number 1 Region: 124-453
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.19e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0024
Further Details:      
 
Domain Number 2 Region: 463-553
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000102
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000157871|PACid:22670351
Sequence length 564
Sequence
MGFLTPIYERIMFIWALITRWLKYRQNFEVNNMNTLRGMLEELISQSEDIIEKLEAEPLL
PSKPQCDEVYEWLENVERIKTQILTIEKLGERKFLSIAHLGKLVDEKIREVEELLEKGSL
FSEISLKKSFKYVIIGGGVAAGYAAREFVKQGLEPGELAIISKEAVAPYERPALSKGYLL
PEGATRLPGFHVCVGSGGEKLLPEWYAEKGIVLLLSTEIVEADLHSKILTSATGGMFEFE
TLIIATGSRVIRLTEFGVQGDHAKNIFYLREISDADKLVEAIRAKKNGKVVIVGGGYIGL
EVGAAIRINKFDVTMVFPEPWCMPRLFTKEIAAFYEGYYANEGVQMIKGTTAVGFDVDTN
GEVKAVKLKDGRVLQADIVVVGVGAKPLIDLFKGXVGEEKGGIQTDGMFETDVPDVYAVG
DVATFHMKLYDDMRRVEHVDHARKSAEHAVRAIRASEEGKCIEEYDYVPYSYSRAFDLSW
TFYGDNVGDLLLFGDPNPASSQLKFGAAWIKDGRIVGAFLEGGTDEENKAIAKVARAQPS
AEYLDTLKREGSSLHISMLTNSQI
Download sequence
Identical sequences MDP0000157871 MDP0000157871|PACid:22670351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]