SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000158643|PACid:22639712 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158643|PACid:22639712
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily L domain-like 4.22e-25
Family Polygalacturonase inhibiting protein PGIP 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000158643|PACid:22639712
Sequence length 205
Sequence
MAQVENTNRYLFYGKYRGDYYEESLVVNLKGKPQIHTKFLFLVISIDVSGNQLSGDIPEE
ITNLAGLIALDLSRNHISGHIPEGISKLKQLESLDLSSNKLTGPIPRSLSLLSFLGYLNL
SNNDFTGLCGAPFLVSCPDDDPDKGKTPKDDGDGNDFIDKWFCLSVGLGFASGPCGPPPV
VSCPGDRDNERILEDDGGDNDFIDK
Download sequence
Identical sequences MDP0000158643 MDP0000158643|PACid:22639712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]