SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000158720|PACid:22655873 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158720|PACid:22655873
Domain Number 1 Region: 61-247,334-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-27
Family HI0933 N-terminal domain-like 0.00069
Further Details:      
 
Domain Number 2 Region: 270-308
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 0.0000628
Family HI0933 insert domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000158720|PACid:22655873
Sequence length 422
Sequence
MSFTLARFTLARSAVRHSRVRSEAAAPAKNNGLLISTPKQKKFTSTAIPTAQNKASEELL
VVVGGGAAGVYGAIRAKTLAPNLNVVIIEKGRPLSKVKISGGGRCNVTNGHCVDTMVLAE
NYPRGHRELKGAFFNTHGPADTMSWFXDQGVELKTEDDGRVFPVSNSSSTIIDCLMSEST
RLGVSLQTGKAVVTASSTDGGKFLLGVENRTFSSPEYVEADYLLIASGNSKQGYSLASQL
GHSIVDPVPSLFTFKIEDXQLRDLSGDLHGDTLWASISKNSLISLAHMLKNCNFYVTGKS
QYKDEFVTAGGVPLSEVSPSLSPSPFLPFFFTFIGSVILCLAFVKISLNTMESKIQSRLF
FAGETHGVLLIVLKSNVCFQVLNVDGITGGFNFQNAWSGGYIAGTSIDGPDEEAVGDVGR
PN
Download sequence
Identical sequences MDP0000158720|PACid:22655873 MDP0000158720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]