SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000158812|PACid:22671950 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158812|PACid:22671950
Domain Number 1 Region: 40-297
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-52
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 357-376,413-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.69e-35
Family Extended AAA-ATPase domain 0.025
Further Details:      
 
Domain Number 3 Region: 759-831
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000033
Family N-terminal domain of adrenodoxin reductase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000158812|PACid:22671950
Sequence length 864
Sequence
MSGWDEGAIYYSDQAQSLGGDGGDAGSNAAAATRHSVLQKFKEFIRSFETQKNVFSYRES
LLHNXKYLLVDIEDLDSFDADLVAKLRSAPSDYLPLFENAAGQVLANLKTKVPGNEGKLE
ERVPEDVQILLTSKEDPASMRQLGAQCISKLIKVSGITIAASRVKAKATYVIVMCKNCKN
VQRVPCRPGLGGAIVPRSCNHIPQPGEEPCPLDPWVVVPDKSKYVDQQTLKLQENPEDVP
TGELPRNMLLSVDRHLVQTIVPGTRLTIMGIYSIYQASNSATSHKGAVAVRQPYIRVVGI
EEATDANTRGPAAFTQDEFSLXSIGLMEYLSTRXXIEEFKKFASEDAYKNICLKIAPSIF
GHADVKKAVACLLFGGSRKVYPEFLSLVLVWFIDGNNPFSCEQHLPDGVKLRGDINVXLL
GDPSTAKSQFLKFVEKTAPVAVYTSXKGSSAAGLTASVIRDSSSREFYLEGGAMVLADGG
VVCIDEFDKMRSEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKT
AQDNIDLQTTILSRFDLIFIVKDIRMYSQDKTIASHIIKVHASAGAALGDGRVVSKEENW
LKRYIQYCRTECHPRLSETASRELQSNYVKIRQDMRQLANETGEAAAVPITVRQLEAIVR
LSEALAKMQLRHEATEEHVREAIRLFNAATMDAAKSGIQQQVNLTGEMANEVKENKRREE
GIGGGWGRMASSSSCSVGSPSSLTQRHRPPPSPSPSCVRYAVLGAGFAGLSVAWHLLKQS
PKDSNIRVDIYDEAGIGGGASGVSGGLLHPYSPKAKLLWRAADCWSESLNLLSAAEAAVA
SAAQNSDGLTPIVRRSICAHFSVS
Download sequence
Identical sequences MDP0000158812 MDP0000158812|PACid:22671950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]