SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000158853|PACid:22672016 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000158853|PACid:22672016
Domain Number 1 Region: 1-360,496-553
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-49
Family FAD-linked reductases, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 345-485
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000471
Family L-aminoacid/polyamine oxidase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000158853|PACid:22672016
Sequence length 558
Sequence
MVAKKSRVVIIGAGMAGVTAANKLYTAAGSKDLFELVVVEGGERIGGRINTSEFGGDRIE
MGATWIHGIEGSPVHKIAQEINALESEQPWECMDGSSDEPTTVAEGGLVLEPDVVDRISS
LFKNLMDYAQGKKVFDESPEIVCNGEFEYGKLGEEASRICASNGGVGKLSVGSFLRRGLD
AYWVLTKNRDEQVNGNGNWSRKLLQEAIFAMHENTQRTYTSAGDLLTLDYNAESEYRMFP
GEEITIAKGYLSIVQSLASVLPPGLIQLGKKVTEIQWQPENHTHSGYESDTRPVKLHFSD
GSVLLAXHVIITVSLGVLKASIRQDSGMFNPPLPRFKTEAISRLGFGVVNKLFLQLGSNH
PPLKSHDFSKFPFLQMVFHRADSELRNKKIPWWMRKTASLCPLYHNSNVLLSWFAGKEAL
ALEALSGEEIINGVSQTVSSFLSHTSHSHESCNGNGNPEGNSVQFSKVLKSQWASDPLFL
GSYSYVAVGSSGEDLDSMAEPLPSDDSGSATSSSPPPLQILFAGEATHRTHYSTTHGAYL
SGLREANRLLQHYQHVGV
Download sequence
Identical sequences MDP0000158853 MDP0000702799 MDP0000158853|PACid:22672016 MDP0000702799|PACid:22650781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]